PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.B00802.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family M-type_MADS
Protein Properties Length: 245aa    MW: 26755.7 Da    PI: 8.1252
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.B00802.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF57.91.3e-181660145
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                    krie +  r+v fskRr+ ++KKA ELS+LC a va+++fs+ g+
  Pahal.B00802.1 16 KRIEGEESRHVCFSKRRQSMFKKACELSILCSAMVAIVVFSPGGR 60
                    79****************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554552.22E-25882IPR002100Transcription factor, MADS-box
SMARTSM004321.4E-27867IPR002100Transcription factor, MADS-box
PROSITE profilePS5006624.852868IPR002100Transcription factor, MADS-box
CDDcd002651.31E-30977No hitNo description
PRINTSPR004043.7E-181030IPR002100Transcription factor, MADS-box
PfamPF003194.9E-221764IPR002100Transcription factor, MADS-box
PRINTSPR004043.7E-183045IPR002100Transcription factor, MADS-box
PRINTSPR004043.7E-184566IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MVKGKTSMGR QKIEMKRIEG EESRHVCFSK RRQSMFKKAC ELSILCSAMV AIVVFSPGGR  60
PFSFGSPSFK AVFNRFLALT VPATSGESCD SSNGETNTTH ESLECSELEQ SIEGEKKREK  120
MLKEAVECDT DGRVMDLLTT KVYTSGLDEL QEFHKKLAAI QGIVKEKIKQ VLQEESHPTK  180
PFPPAFMDLA SKYLLDRLIA TRIPSMAPNS NHGVAGGLDV NASLASSVYA VGTPPKYPSN  240
QLDG*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004986970.11e-123PREDICTED: agamous-like MADS-box protein AGL29
TrEMBLK4AJ951e-128K4AJ95_SETIT; Uncharacterized protein
STRINGSi038960m1e-127(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP157431316
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34440.18e-32AGAMOUS-like 29